Prefolds 
Contour Diapers
Fitted Diapers
Diaper Covers
Pocket Diapers
All-in-twos
All-In-Ones
Swim Diapers
Inserts and Doublers
Packages
Training pants
Diaper Accessories
Fun finds (and for mom)
Diaper washing and baby care
MN/WI Made
Brands
Gently Used Diapers
Gift Bag
Insurance
Featured Items
Sale Items
All Items


Home
Search Catalog
Why Cloth Diapers?
Types of Diapers
How to Wash
Due Tomorrow?
Consignment
Event Calendar
Gift Certificates
Gift Registry
Site Map
Links
Wholesale
Order Tracking
Contact
Guest Book
About Sweet Pickles
Store Policies


View Your Cart


Enter Coupon Code:


Thirsties Fab Fitted Diapers

Shop > Thirsties Fab Fitted Diapers

Thirsties Fab Fitted Diapers-Thirsties fab fitted
Thirsties Fab Fitted Diapers-Thirsties fab fitted
Buy 3 or more and receive $0.25 off
Buy 6 or more and receive $0.50 off
Buy 12 or more and receive $0.75 off
Price:Was $14.50 Sale! $12.00
size/color in stock:
size/color special order (3-4 days to arrive):
Qty:  

We only stock this diaper in white. If you would like other colors, they will ship directly from the manufacturer.

Thirsties Fab Fitted Diapers:

  • Are expertly crafted from stretchy and buttery soft textiles with a great stay-dry protection with their special liner that offers wetness protection for your baby's delicate skin.
  • Have encased elastic wraps that snugly yet gently fit around baby's legs and torso and provide superior protection from leaks.
  • Are simply wrapped around baby and secured with the sturdy Aplix velcro closures.
  • Include an internal soaker composed of spongy, microfiber terry cloth that can absorb up to seven times its weight in liquid. A maximum absorbency of 18 ounce makes this diaper appropriate for light and most heavy wetters alike.
  • Are irresistibly cute and soft to the touch. You are not going to want to cover these diapers.
  • Touch your baby's skin in an entirely unique microfleece that is oh-so-soft to the touch and works to keep your baby feeling dry, helping to prevent diaper rash.

Thirsties Fab Fitted diapers are not waterproof on their own.

Other things to remember about this diaper:
  • It is important to use residue free detergent.
  • Don't use fabric softeners or bleach.
  • Inner Soaker and inner liner: 100% polyester
  • Outer layer: 15% polyester/85% cotton
  • Made in U.S.A.
We are often asked, "Why would I consider purchasing a 2-piece system when I can invest in Thirsties Pocket All-In-One (AIO) diapers for about the same price?"  The answer is simple...a Thirsties Fab Fitted paired with a Thirsties Diaper Cover offers superior leakproof protection!  Why?  Because fitted cloth diapers offer an additional elasticized barrier around the legs and waist that makes it much tougher for anything to escape beyond the diaper cover.

Available in four different sizes:

  • Extra small( 6- 12 lbs/ 3- 5.5 kg)
  • Small( 12- 18 lbs/ 5.5- 8 kg,)
  • Medium( 18- 28 lbs/ 8- 12.5 kg)
  • Large( 28- 40 lbs/ 12.5- 18 kg)
Other colors available, they will be ordered directly from the manufacturer and ship in 1-2 days.
Aqua, Butter, Celery, Melon,Raspberry, Sky Blue, Periwinkle, Lavender
fittedaquafittedbutterfittedceleryfittedmelonfittedraspberryfittedskybluefittedperiwinklefittedlavender


Tell a Friend Tell a Friend

Home | Search Catalog | Why Cloth Diapers? | Types of Diapers | How to Wash | Due Tomorrow? | Consignment | Event Calendar | Gift Certificates | Gift Registry | Site Map | Links | Wholesale | Order Tracking | Contact | Guest Book | About Sweet Pickles | Store Policies

© Copyright 2009 Sweet Pickles LLC. All Rights Reserved.
Site designed by MyDreamWeb Design | Powered by AlohaShop