Prefolds 
Fitted and Contour Diapers
Diaper Covers
Pocket Diapers
All-in-Ones and All-in-Twos
Swim Diapers
Inserts and Doublers
Packages
Training pants
Diaper Accessories
Diaper washing and baby care
Fun finds (and for mom)
Made in USA
Manufactured Outside the US
Gently Used Diapers
Insurance
Clearance!!
Featured Items
Sale Items
All Items


Home
Search Catalog
Why Cloth Diapers?
Types of Diapers
How to Wash
Event Calendar
Gift Certificates
Gift Registry
Site Map
Links
Order Tracking
Layaway
Contact
About Sweet Pickles
Store Policies
DiaperSwap


View Your Cart


Enter Coupon Code:


Thirsties Fab Fitted Diapers

Shop > Thirsties Fab Fitted Diapers

Thirsties Fab Fitted Diapers-Thirsties fab fitted
Thirsties Fab Fitted Diapers-Thirsties fab fitted
Price:$14.50
size/color in stock:
Qty:  

This item has been discontinued by Thirsties. A new product will be coming out soon (date not yet announced by Thirsties). Inventory listed is all that is available.

Thirsties Fab Fitted Diapers:

  • Are expertly crafted from stretchy and buttery soft textiles with a great stay-dry protection with their special liner that offers wetness protection for your baby's delicate skin.
  • Have encased elastic wraps that snugly yet gently fit around baby's legs and torso and provide superior protection from leaks.
  • Are simply wrapped around baby and secured with the sturdy Aplix velcro closures.
  • Include an internal soaker composed of spongy, microfiber terry cloth that can absorb up to seven times its weight in liquid. A maximum absorbency of 18 ounce makes this diaper appropriate for light and most heavy wetters alike.
  • Are irresistibly cute and soft to the touch. You are not going to want to cover these diapers.
  • Touch your baby's skin in an entirely unique microfleece that is oh-so-soft to the touch and works to keep your baby feeling dry, helping to prevent diaper rash.

Thirsties Fab Fitted diapers are not waterproof on their own.

Other things to remember about this diaper:
  • It is important to use residue free detergent.
  • Don't use fabric softeners or bleach.
  • Inner Soaker and inner liner: 100% polyester
  • Outer layer: 15% polyester/85% cotton
  • Made in U.S.A.
We are often asked, "Why would I consider purchasing a 2-piece system when I can invest in Thirsties Pocket All-In-One (AIO) diapers for about the same price?"  The answer is simple...a Thirsties Fab Fitted paired with a Thirsties Diaper Cover offers superior leakproof protection!  Why?  Because fitted cloth diapers offer an additional elasticized barrier around the legs and waist that makes it much tougher for anything to escape beyond the diaper cover.

Available in four different sizes:

  • Extra small( 6- 12 lbs/ 3- 5.5 kg)
  • Small( 12- 18 lbs/ 5.5- 8 kg,)
  • Medium( 18- 28 lbs/ 8- 12.5 kg)
  • Large( 28- 40 lbs/ 12.5- 18 kg)
Other colors available, they will be ordered directly from the manufacturer and ship in 1-2 days.
Aqua, Butter, Celery, Melon,Raspberry, Sky Blue, Periwinkle, Lavender
fittedaquafittedbutterfittedceleryfittedmelonfittedraspberryfittedskybluefittedperiwinklefittedlavender


Tell a Friend Tell a Friend

We think you may also like:

Heiny Hugger Sherpa Fitted Diaper-Cotton, fitted diaper, Happy Heiny
Heiny Hugger Sherpa Fitted Diaper

Home | Search Catalog | Why Cloth Diapers? | Types of Diapers | How to Wash | Event Calendar | Gift Certificates | Gift Registry | Site Map | Links | Order Tracking | Layaway | Contact | About Sweet Pickles | Store Policies | DiaperSwap

© Copyright 2009 Sweet Pickles LLC. All Rights Reserved.
Site designed by MyDreamWeb Design | Powered by AlohaShop